![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.4: RNA ligase [103286] (2 proteins) |
![]() | Protein RNA editing ligase MP52 [118125] (1 species) |
![]() | Species Trypanosoma brucei [TaxId:5691] [118126] (1 PDB entry) |
![]() | Domain d1xdna_: 1xdn A: [115168] complexed with atp, mg |
PDB Entry: 1xdn (more details), 1.2 Å
SCOP Domain Sequences for d1xdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdna_ d.142.2.4 (A:) RNA editing ligase MP52 {Trypanosoma brucei [TaxId: 5691]} qsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvrfakr sgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykhplvp ksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgydefv efsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvirhvr rgdpavekhnvstiiklrcssfmel
Timeline for d1xdna_: