Lineage for d1xdna_ (1xdn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979366Family d.142.2.4: RNA ligase [103286] (2 proteins)
  6. 2979367Protein RNA editing ligase MP52 [118125] (1 species)
  7. 2979368Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [118126] (1 PDB entry)
    Uniprot P82863 52-316
  8. 2979369Domain d1xdna_: 1xdn A: [115168]
    complexed with atp, mg

Details for d1xdna_

PDB Entry: 1xdn (more details), 1.2 Å

PDB Description: High resolution crystal structure of an editosome enzyme from trypanosoma brucei: RNA editing ligase 1
PDB Compounds: (A:) RNA editing ligase MP52

SCOPe Domain Sequences for d1xdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdna_ d.142.2.4 (A:) RNA editing ligase MP52 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
qsdfspyieidlpsesriqslhksglaaqewvacekvhgtnfgiylinqgdhevvrfakr
sgimdpnenffgyhilideftaqirilndllkqkyglsrvgrlvlngelfgakykhplvp
ksekwctlpngkkfpiagvqiqrepfpqyspelhffafdikysvsgaeedfvllgydefv
efsskvpnllyaralvrgtldeclafdvenfmtplpallglgnyplegnlaegvvirhvr
rgdpavekhnvstiiklrcssfmel

SCOPe Domain Coordinates for d1xdna_:

Click to download the PDB-style file with coordinates for d1xdna_.
(The format of our PDB-style files is described here.)

Timeline for d1xdna_: