Lineage for d1xdkb_ (1xdk B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776928Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)
  7. 776931Species Mouse (Mus musculus) [TaxId:10090] [117012] (1 PDB entry)
    Uniprot P22605 209-453
  8. 776932Domain d1xdkb_: 1xdk B: [115165]
    Other proteins in same PDB: d1xdka_, d1xdke_

Details for d1xdkb_

PDB Entry: 1xdk (more details), 2.9 Å

PDB Description: crystal structure of the rarbeta/rxralpha ligand binding domain heterodimer in complex with 9-cis retinoic acid and a fragment of the trap220 coactivator
PDB Compounds: (B:) Retinoic acid receptor, beta

SCOP Domain Sequences for d1xdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdkb_ a.123.1.1 (B:) Retinoic acid receptor beta (RAR-beta) {Mouse (Mus musculus) [TaxId: 10090]}
aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
yirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlenseghe
pltps

SCOP Domain Coordinates for d1xdkb_:

Click to download the PDB-style file with coordinates for d1xdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1xdkb_: