Lineage for d1xdib2 (1xdi B:349-466)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528301Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2528313Species Mycobacterium tuberculosis [TaxId:1773] [118041] (1 PDB entry)
    Uniprot O53355
  8. 2528315Domain d1xdib2: 1xdi B:349-466 [115163]
    Other proteins in same PDB: d1xdia1, d1xdib1
    complexed with fad

Details for d1xdib2

PDB Entry: 1xdi (more details), 2.81 Å

PDB Description: Crystal structure of LpdA (Rv3303c) from Mycobacterium tuberculosis
PDB Compounds: (B:) Rv3303c-lpdA

SCOPe Domain Sequences for d1xdib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdib2 d.87.1.1 (B:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}
lrtvaatvftrpeiaavgvpqsvidagsvaartimlplrtnarakmsemrhgfvkifcrr
stgvviggvvvapiaselilpiavavqnritvnelaqtlavypslsgsiteaarrlma

SCOPe Domain Coordinates for d1xdib2:

Click to download the PDB-style file with coordinates for d1xdib2.
(The format of our PDB-style files is described here.)

Timeline for d1xdib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdib1