Lineage for d1xdib1 (1xdi B:2-161,B:276-348)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein Dihydrolipoamide dehydrogenase, N- and C-terminal domain [418938] (8 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [117441] (1 PDB entry)
    Uniprot O53355
  8. Domain d1xdib1: 1xdi B:2-161,B:276-348 [115162]
    Other proteins in same PDB: d1xdia2, d1xdib2
    complexed with fad

Details for d1xdib1

PDB Entry: 1xdi (more details), 2.81 Å

PDB Description: Crystal structure of LpdA (Rv3303c) from Mycobacterium tuberculosis
PDB Compounds: (B:) Rv3303c-lpdA

SCOPe Domain Sequences for d1xdib1:

Sequence, based on SEQRES records: (download)

>d1xdib1 c.3.1.5 (B:2-161,B:276-348) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
telrraphlgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgelid
stpglarhrikataadgstseheadvvlvatgasprilpsXgsvpntsglglervgiqlg
rgnyltvdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspir

Sequence, based on observed residues (ATOM records): (download)

>d1xdib1 c.3.1.5 (B:2-161,B:276-348) Dihydrolipoamide dehydrogenase, N- and C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
telrraphlgfhkislpqiharvktlaaaqsaditaqllsmgvqviagrgelidstpgla
rhrikataadgstseheadvvlvatgasprilpsXgsvpntsglglervgiqlgrgnylt
vdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspir

SCOPe Domain Coordinates for d1xdib1 are not available.

Timeline for d1xdib1:

Domains from same chain:
(mouse over for more information)
d1xdib2
Domains from other chains:
(mouse over for more information)
d1xdia1, d1xdia2