Lineage for d1xdia1 (1xdi A:2-161,A:276-348)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576622Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 576639Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 576664Species Mycobacterium tuberculosis [TaxId:1773] [117441] (1 PDB entry)
  8. 576665Domain d1xdia1: 1xdi A:2-161,A:276-348 [115160]
    Other proteins in same PDB: d1xdia2, d1xdib2

Details for d1xdia1

PDB Entry: 1xdi (more details), 2.81 Å

PDB Description: Crystal structure of LpdA (Rv3303c) from Mycobacterium tuberculosis

SCOP Domain Sequences for d1xdia1:

Sequence, based on SEQRES records: (download)

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis}
vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
telrraphlgfhidfddakislpqiharvktlaaaqsaditaqllsmgvqviagrgelid
stpglarhrikataadgstseheadvvlvatgasprilpsXgsvpntsglglervgiqlg
rgnyltvdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspir

Sequence, based on observed residues (ATOM records): (download)

>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis}
vtrivilgggpagyeaalvaatshpettqvtvidcdgiggaavlddcvpsktfiastglr
telrraphlgfhkislpqiharvktlaaaqsaditaqllsmgvqviagrgelidstpgla
rhrikataadgstseheadvvlvatgasprilpsXgsvpntsglglervgiqlgrgnylt
vdrvsrtlatgiyaagdctgllplasvaamqgriamyhalgegvspir

SCOP Domain Coordinates for d1xdia1:

Click to download the PDB-style file with coordinates for d1xdia1.
(The format of our PDB-style files is described here.)

Timeline for d1xdia1:

Domains from same chain:
(mouse over for more information)
d1xdia2
Domains from other chains:
(mouse over for more information)
d1xdib1, d1xdib2