Lineage for d1xd6a_ (1xd6 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)
  6. Protein Gastrodianin (antifungal protein) [117304] (1 species)
  7. Species Gastrodia elata [TaxId:91201] [117305] (2 PDB entries)
    Uniprot Q9AXZ2 29-140 # different isoforms
  8. Domain d1xd6a_: 1xd6 A: [115159]
    complexed with so4

Details for d1xd6a_

PDB Entry: 1xd6 (more details), 2 Å

PDB Description: Crystal structures of novel monomeric monocot mannose-binding lectins from Gastrodia elata
PDB Compounds: (A:) gastrodianin-4

SCOPe Domain Sequences for d1xd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd6a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]}
sdrlnagkslgaggslaegpylfimqndcnlvlydnnravwasgtngkasncilkmqrdg
nlviysgsramwasntnrqdgnyylilqrdrnvviydnsnnaiwasgtnv

SCOPe Domain Coordinates for d1xd6a_ are not available.

Timeline for d1xd6a_: