SCOPe 2.05: Domain d1xd5c_: 1xd5 C:

Lineage for d1xd5c_ (1xd5 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)

6. Protein Gastrodianin (antifungal protein) [117304] (1 species)

7. Species Gastrodia elata [TaxId:91201] [117305] (2 PDB entries)
   Uniprot Q9AXZ2 29-140 # different isoforms

8. Domain d1xd5c_: 1xd5 C: [115157]
   complexed with so4

Details for d1xd5c_

PDB Entry: 1xd5, 2 Å

PDB Description: Crystal structures of novel monomeric monocot mannose-binding lectins from Gastrodia elata

PDB Compounds: (C:) antifungal protein GAFP-1

SCOPe Domain Sequences for d1xd5c_:

Sequence; same for both SEQRES and ATOM records:

>d1xd5c_ b.78.1.1 (C:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]}
sdrlnsghqldtggslaeggylfiiqndcnlvlydnnravwasgtngkasgcvlkmqndg
nlviysgsraiwasntnrqngnyylilqrdrnvviydnsnnaiwathtnvg

Timeline for d1xd5c_:

• d1xd5c_ first appeared in SCOP 1.71
  
• d1xd5c_ appears in SCOPe 2.04
  
• d1xd5c_ appears in SCOPe 2.06
  
• d1xd5c_ appears in the current release, SCOPe 2.08