Lineage for d1xd5a_ (1xd5 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566848Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 566849Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (1 family) (S)
  5. 566850Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (3 proteins)
  6. 566865Protein Gastrodianin (antifungal protein) [117304] (1 species)
  7. 566866Species Gastrodia elata [TaxId:91201] [117305] (2 PDB entries)
  8. 566867Domain d1xd5a_: 1xd5 A: [115155]

Details for d1xd5a_

PDB Entry: 1xd5 (more details), 2 Å

PDB Description: Crystal structures of novel monomeric monocot mannose-binding lectins from Gastrodia elata

SCOP Domain Sequences for d1xd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata}
sdrlnsghqldtggslaeggylfiiqndcnlvlydnnravwasgtngkasgcvlkmqndg
nlviysgsraiwasntnrqngnyylilqrdrnvviydnsnnaiwathtnvgn

SCOP Domain Coordinates for d1xd5a_:

Click to download the PDB-style file with coordinates for d1xd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xd5a_: