Lineage for d1xd4b3 (1xd4 B:419-549)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412810Protein Son of sevenless-1 (sos-1) [50742] (2 species)
  7. 2412811Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries)
    Uniprot Q07889 189-1046
  8. 2412816Domain d1xd4b3: 1xd4 B:419-549 [115154]
    Other proteins in same PDB: d1xd4a1, d1xd4a2, d1xd4b1, d1xd4b2

Details for d1xd4b3

PDB Entry: 1xd4 (more details), 3.64 Å

PDB Description: crystal structure of the dh-ph-cat module of son of sevenless (sos)
PDB Compounds: (B:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd4b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd4b3 b.55.1.1 (B:419-549) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
ikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqp
rlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwm
aalislqyrst

SCOPe Domain Coordinates for d1xd4b3:

Click to download the PDB-style file with coordinates for d1xd4b3.
(The format of our PDB-style files is described here.)

Timeline for d1xd4b3: