Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Son of sevenless-1 (sos-1) [50742] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries) Uniprot Q07889 189-1046 |
Domain d1xd4a3: 1xd4 A:419-549 [115151] Other proteins in same PDB: d1xd4a1, d1xd4a2, d1xd4b1, d1xd4b2 |
PDB Entry: 1xd4 (more details), 3.64 Å
SCOPe Domain Sequences for d1xd4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xd4a3 b.55.1.1 (A:419-549) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} ikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqp rlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwm aalislqyrst
Timeline for d1xd4a3: