Lineage for d1xd2c_ (1xd2 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006307Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2006308Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2006309Family a.117.1.1: Ras GEF [48367] (2 protein domains)
  6. 2006310Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2006311Species Human (Homo sapiens) [TaxId:9606] [48369] (11 PDB entries)
    Uniprot Q07889 189-1046
  8. 2006316Domain d1xd2c_: 1xd2 C: [115144]
    Other proteins in same PDB: d1xd2a_, d1xd2b_
    complexed with gdp, mg, po4

Details for d1xd2c_

PDB Entry: 1xd2 (more details), 2.7 Å

PDB Description: Crystal Structure of a ternary Ras:SOS:Ras*GDP complex
PDB Compounds: (C:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd2c_:

Sequence, based on SEQRES records: (download)

>d1xd2c_ a.117.1.1 (C:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d1xd2c_ a.117.1.1 (C:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d1xd2c_:

Click to download the PDB-style file with coordinates for d1xd2c_.
(The format of our PDB-style files is described here.)

Timeline for d1xd2c_: