Lineage for d1xd2a_ (1xd2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124335Protein cH-p21 Ras protein [52593] (1 species)
  7. 2124336Species Human (Homo sapiens) [TaxId:9606] [52594] (116 PDB entries)
    Uniprot Q6P716
  8. 2124441Domain d1xd2a_: 1xd2 A: [115142]
    Other proteins in same PDB: d1xd2c_
    complexed with gdp, mg, po4

Details for d1xd2a_

PDB Entry: 1xd2 (more details), 2.7 Å

PDB Description: crystal structure of a ternary ras:sos:ras*gdp complex
PDB Compounds: (A:) transforming protein p21/h-ras-1

SCOPe Domain Sequences for d1xd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd2a_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d1xd2a_:

Click to download the PDB-style file with coordinates for d1xd2a_.
(The format of our PDB-style files is described here.)

Timeline for d1xd2a_: