Lineage for d1xcwa1 (1xcw A:404-496)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808172Protein Animal alpha-amylase [51024] (3 species)
  7. 808173Species Human (Homo sapiens) [TaxId:9606] [51026] (42 PDB entries)
    Uniprot P04746 16-511
    SQ 04746
    Uniprot P04746 16-511 ! SQ 04746
  8. 808196Domain d1xcwa1: 1xcw A:404-496 [115134]
    Other proteins in same PDB: d1xcwa2
    complexed with 3sa, ca, cl, nag

Details for d1xcwa1

PDB Entry: 1xcw (more details), 2 Å

PDB Description: acarbose rearrangement mechanism implied by the kinetic and structural analysis of human pancreatic alpha-amylase in complex with analogues and their elongated counterparts
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1xcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcwa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1xcwa1:

Click to download the PDB-style file with coordinates for d1xcwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xcwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xcwa2