Lineage for d1xcof_ (1xco F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873551Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1873552Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1873849Family c.77.1.5: Phosphotransacetylase [102663] (3 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 1873853Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 1873854Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
    Uniprot P39646
  8. 1873860Domain d1xcof_: 1xco F: [115133]
    Structural genomics target
    complexed with so4, uvw

Details for d1xcof_

PDB Entry: 1xco (more details), 2.85 Å

PDB Description: Crystal Structure of a Phosphotransacetylase from Bacillus subtilis in complex with acetylphosphate
PDB Compounds: (F:) Phosphate acetyltransferase

SCOPe Domain Sequences for d1xcof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcof_ c.77.1.5 (F:) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

SCOPe Domain Coordinates for d1xcof_:

Click to download the PDB-style file with coordinates for d1xcof_.
(The format of our PDB-style files is described here.)

Timeline for d1xcof_: