SCOP 1.71: Domain d1xcoc_: 1xco C:

Lineage for d1xcoc_ (1xco C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.5: Phosphotransacetylase [102663] (2 proteins)
   Pfam 01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families

6. Protein Phosphotransacetylase Pta [110717] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)

8. Domain d1xcoc_: 1xco C: [115130]

Details for d1xcoc_

PDB Entry: 1xco, 2.85 Å

PDB Description: Crystal Structure of a Phosphotransacetylase from Bacillus subtilis in complex with acetylphosphate

SCOP Domain Sequences for d1xcoc_:

Sequence; same for both SEQRES and ATOM records:

>d1xcoc_ c.77.1.5 (C:) Phosphotransacetylase Pta {Bacillus subtilis}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

Timeline for d1xcoc_:

• d1xcoc_ is new in SCOP 1.71
  
• d1xcoc_ appears in SCOP 1.73
  
• d1xcoc_ appears in the current release, SCOPe 2.08