SCOPe 2.08: Domain d1xcob1: 1xco B:1-323

Lineage for d1xcob1 (1xco B:1-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.5: Phosphotransacetylase [102663] (3 proteins)
   Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families

6. Protein Phosphotransacetylase Pta [110717] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries)
   Uniprot P39646

8. Domain d1xcob1: 1xco B:1-323 [115129]
   Other proteins in same PDB: d1xcoa2, d1xcob2, d1xcod2, d1xcoe2
   Structural genomics target
   complexed with so4, uvw

Details for d1xcob1

PDB Entry: 1xco, 2.85 Å

PDB Description: Crystal Structure of a Phosphotransacetylase from Bacillus subtilis in complex with acetylphosphate

PDB Compounds: (B:) Phosphate acetyltransferase

SCOPe Domain Sequences for d1xcob1:

Sequence; same for both SEQRES and ATOM records:

>d1xcob1 c.77.1.5 (B:1-323) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]}
madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
dlsrgcnaedvynlalitaaqal

Timeline for d1xcob1:

• d1xcob1 first appeared in SCOP 1.71, called d1xcob_
  
• d1xcob1 appears in SCOPe 2.07