![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.5: Phosphotransacetylase [102663] (3 proteins) Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families |
![]() | Protein Phosphotransacetylase Pta [110717] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117726] (2 PDB entries) Uniprot P39646 |
![]() | Domain d1xcoa1: 1xco A:1-323 [115128] Other proteins in same PDB: d1xcoa2, d1xcob2, d1xcod2, d1xcoe2 Structural genomics target complexed with so4, uvw |
PDB Entry: 1xco (more details), 2.85 Å
SCOPe Domain Sequences for d1xcoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcoa1 c.77.1.5 (A:1-323) Phosphotransacetylase Pta {Bacillus subtilis [TaxId: 1423]} madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn dlsrgcnaedvynlalitaaqal
Timeline for d1xcoa1: