Lineage for d1xcla_ (1xcl A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588802Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 588803Protein Guanidinoacetate methyltransferase [69551] (1 species)
    a template structure of protein arginine methyltransferase
  7. 588804Species Rat (Rattus norvegicus) [TaxId:10116] [69552] (5 PDB entries)
  8. 588805Domain d1xcla_: 1xcl A: [115127]
    complexed with gai, sah

Details for d1xcla_

PDB Entry: 1xcl (more details), 2 Å

PDB Description: guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidine

SCOP Domain Sequences for d1xcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcla_ c.66.1.16 (A:) Guanidinoacetate methyltransferase {Rat (Rattus norvegicus)}
plfapgedcgpawraapaaydtsdthlqilgkpvmerwetpymhslaaaaasrggrvlev
gfgmaiaasrvqqapikehwiiecndgvfqrlqnwalkqphkvvplkglweevaptlpdg
hfdgilydtyplseetwhthqfnfikthafrllkpggiltycnltswgelmkskytdita
mfeetqvpalleagfqrenictevmalvppadcryyafpqmitplvtkh

SCOP Domain Coordinates for d1xcla_:

Click to download the PDB-style file with coordinates for d1xcla_.
(The format of our PDB-style files is described here.)

Timeline for d1xcla_: