Lineage for d1xcla_ (1xcl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893321Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 2893322Protein Guanidinoacetate methyltransferase [69551] (2 species)
    a template structure of protein arginine methyltransferase
  7. 2893332Species Norway rat (Rattus norvegicus) [TaxId:10116] [69552] (5 PDB entries)
    Uniprot P10868
  8. 2893333Domain d1xcla_: 1xcl A: [115127]
    complexed with gai, sah

Details for d1xcla_

PDB Entry: 1xcl (more details), 2 Å

PDB Description: guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidine
PDB Compounds: (A:) Guanidinoacetate N-methyltransferase

SCOPe Domain Sequences for d1xcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcla_ c.66.1.16 (A:) Guanidinoacetate methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plfapgedcgpawraapaaydtsdthlqilgkpvmerwetpymhslaaaaasrggrvlev
gfgmaiaasrvqqapikehwiiecndgvfqrlqnwalkqphkvvplkglweevaptlpdg
hfdgilydtyplseetwhthqfnfikthafrllkpggiltycnltswgelmkskytdita
mfeetqvpalleagfqrenictevmalvppadcryyafpqmitplvtkh

SCOPe Domain Coordinates for d1xcla_:

Click to download the PDB-style file with coordinates for d1xcla_.
(The format of our PDB-style files is described here.)

Timeline for d1xcla_: