Lineage for d1xcja_ (1xcj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501068Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 2501069Protein Guanidinoacetate methyltransferase [69551] (2 species)
    a template structure of protein arginine methyltransferase
  7. 2501079Species Norway rat (Rattus norvegicus) [TaxId:10116] [69552] (5 PDB entries)
    Uniprot P10868
  8. 2501081Domain d1xcja_: 1xcj A: [115126]
    complexed with nmg, sah

Details for d1xcja_

PDB Entry: 1xcj (more details), 2 Å

PDB Description: guanidinoacetate methyltransferase containing s-adenosylhomocysteine and guanidinoacetate
PDB Compounds: (A:) Guanidinoacetate N-methyltransferase

SCOPe Domain Sequences for d1xcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcja_ c.66.1.16 (A:) Guanidinoacetate methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plfapgedcgpawraapaaydtsdthlqilgkpvmerwetpymhslaaaaasrggrvlev
gfgmaiaasrvqqapikehwiiecndgvfqrlqnwalkqphkvvplkglweevaptlpdg
hfdgilydtyplseetwhthqfnfikthafrllkpggiltycnltswgelmkskytdita
mfeetqvpalleagfqrenictevmalvppadcryyafpqmitplvtkh

SCOPe Domain Coordinates for d1xcja_:

Click to download the PDB-style file with coordinates for d1xcja_.
(The format of our PDB-style files is described here.)

Timeline for d1xcja_: