Lineage for d1xcda_ (1xcd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851868Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
    applies to all domains of a family if the common domain is composed of a different number of small repeating units
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 2851869Protein Decorin [117463] (1 species)
  7. 2851870Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries)
    Uniprot P21793 52-356
  8. 2851872Domain d1xcda_: 1xcd A: [115117]
    complexed with nag, trs
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1xcda_

PDB Entry: 1xcd (more details), 2.31 Å

PDB Description: dimeric bovine tissue-extracted decorin, crystal form 1
PDB Compounds: (A:) Decorin

SCOPe Domain Sequences for d1xcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcda_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}
gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl
ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf
nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg
nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad
hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr
aavql

SCOPe Domain Coordinates for d1xcda_:

Click to download the PDB-style file with coordinates for d1xcda_.
(The format of our PDB-style files is described here.)

Timeline for d1xcda_: