![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) applies to all domains of a family if the common domain is composed of a different number of small repeating units this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
![]() | Protein Decorin [117463] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [117464] (3 PDB entries) Uniprot P21793 52-356 |
![]() | Domain d1xcda_: 1xcd A: [115117] complexed with nag, trs applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1xcd (more details), 2.31 Å
SCOPe Domain Sequences for d1xcda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcda_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} gpvcpfrcqchlrvvqcsdlglekvpkdlppdtalldlqnnkiteikdgdfknlknlhtl ilinnkiskispgafaplvklerlylsknqlkelpekmpktlqelrvheneitkvrksvf nglnqmivvelgtnplkssgiengafqgmkklsyiriadtnittipqglppsltelhldg nkitkvdaaslkglnnlaklglsfnsisavdngslantphlrelhlnnnklvkvpgglad hkyiqvvylhnnnisaigsndfcppgyntkkasysgvslfsnpvqyweiqpstfrcvyvr aavql
Timeline for d1xcda_: