SCOPe 2.05: Domain d1xccc_: 1xcc C:

Lineage for d1xccc_ (1xcc C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein 1-Cys peroxiredoxin [52909] (3 species)

7. Species Plasmodium yoelii yoelii [TaxId:73239] [117599] (2 PDB entries)
   Uniprot Q7RGR1

8. Domain d1xccc_: 1xcc C: [115115]

Details for d1xccc_

PDB Entry: 1xcc, 2.3 Å

PDB Description: 1-cys peroxidoxin from plasmodium yoelli

PDB Compounds: (C:) 1-Cys peroxiredoxin

SCOPe Domain Sequences for d1xccc_:

Sequence; same for both SEQRES and ATOM records:

>d1xccc_ c.47.1.10 (C:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]}
yhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedfl
klnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdit
glpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwnegd
kccviptlqddeiskhfkneitkvempskkkylrfvnl

Timeline for d1xccc_:

• d1xccc_ first appeared in SCOP 1.71
  
• d1xccc_ appears in SCOPe 2.04
  
• d1xccc_ appears in SCOPe 2.06
  
• d1xccc_ appears in the current release, SCOPe 2.08