Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein 1-Cys peroxiredoxin [52909] (3 species) |
Species Plasmodium yoelii yoelii [TaxId:73239] [117599] (2 PDB entries) Uniprot Q7RGR1 |
Domain d1xcca_: 1xcc A: [115113] |
PDB Entry: 1xcc (more details), 2.3 Å
SCOPe Domain Sequences for d1xcca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} gyhlgatfpnftakasgidgdfelykyienswailfshpndftpvcttelaelgkmhedf lklnckligfscnskeshdkwiedikyygklnkweipivcdesrelanklkimdeqekdi tglpltcrclffispekkikatvlypattgrnaheilrvlkslqltyttpvatpvnwneg dkccviptlqddeiskhfkneitkvempskkkylrfvnl
Timeline for d1xcca_: