Lineage for d1xc9a1 (1xc9 A:297-468)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1859846Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1859847Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (43 PDB entries)
    Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
  8. 1859875Domain d1xc9a1: 1xc9 A:297-468 [115111]
    Other proteins in same PDB: d1xc9a2
    protein/DNA complex; complexed with bap, mg, so4, suc

Details for d1xc9a1

PDB Entry: 1xc9 (more details), 1.9 Å

PDB Description: structure of a high-fidelity polymerase bound to a benzo[a]pyrene adduct that blocks replication
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1xc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc9a1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d1xc9a1:

Click to download the PDB-style file with coordinates for d1xc9a1.
(The format of our PDB-style files is described here.)

Timeline for d1xc9a1: