Lineage for d1xc6a5 (1xc6 A:41-394)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832329Family c.1.8.14: Glycosyl hydrolases family 35 catalytic domain [117375] (1 protein)
    Pfam PF01301
  6. 2832330Protein Beta-galactosidase LacA, N-terminal domain [117376] (1 species)
  7. 2832331Species Penicillium sp. [TaxId:5081] [117377] (2 PDB entries)
    Uniprot Q700S9 41-1011
  8. 2832333Domain d1xc6a5: 1xc6 A:41-394 [115110]
    Other proteins in same PDB: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a4
    complexed with edo, gal, iod, na, nag, po4

Details for d1xc6a5

PDB Entry: 1xc6 (more details), 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1xc6a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc6a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]}
llqkyvtwdehsifvngerlmifsgevhpyrlpvaslyidifekvkalgfncvsfyvdwa
llegnpghysaegifdlqpffdaakeagiyllarpgpyinaevsgggfpgwlqrvdgilr
tsdeaylkatdnyasniaatiakaqitnggpiilyqpeneysgaccgyngfpdgsymqyi
edhardagivvpfisndawaaghnapgtgagavdiyghdsyplgfdcanpstwpsgnlpt
yfhtsheqqspstpyslvefqggafdpwggvgfakcaallnhefervfykndfsfgvafl
nlymifggtnwgnlghpggytsydygsaisesrnitrekyselkllgnfakvsp

SCOPe Domain Coordinates for d1xc6a5:

Click to download the PDB-style file with coordinates for d1xc6a5.
(The format of our PDB-style files is described here.)

Timeline for d1xc6a5: