Lineage for d1xc6a4 (1xc6 A:395-569)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077457Family b.71.1.5: Beta-galactosidase LacA, domain 2 [117301] (1 protein)
    contains extra C-terminal beta-sandwich subdomain [greek-key; partial topological similarity to the immunoglobulin-like fold]
    automatically mapped to Pfam PF10435
  6. 2077458Protein Beta-galactosidase LacA, domain 2 [117302] (1 species)
  7. 2077459Species Penicillium sp. [TaxId:5081] [117303] (2 PDB entries)
    Uniprot Q700S9 41-1011
  8. 2077461Domain d1xc6a4: 1xc6 A:395-569 [115109]
    Other proteins in same PDB: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a5
    complexed with edo, gal, iod, na, nag, po4

Details for d1xc6a4

PDB Entry: 1xc6 (more details), 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1xc6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc6a4 b.71.1.5 (A:395-569) Beta-galactosidase LacA, domain 2 {Penicillium sp. [TaxId: 5081]}
gylvanpgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsa
gnltipqlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpge
hhefavsgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflld

SCOPe Domain Coordinates for d1xc6a4:

Click to download the PDB-style file with coordinates for d1xc6a4.
(The format of our PDB-style files is described here.)

Timeline for d1xc6a4: