SCOPe 2.01: Domain d1xc6a4: 1xc6 A:395-569

Lineage for d1xc6a4 (1xc6 A:395-569)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.5: Beta-galactosidase LacA, domain 2 [117301] (1 protein)
   contains extra C-terminal beta-sandwich subdomain [greek-key; partial topological similarity to the immunoglobulin-like fold]

6. Protein Beta-galactosidase LacA, domain 2 [117302] (1 species)

7. Species Penicillium sp. [TaxId:5081] [117303] (2 PDB entries)
   Uniprot Q700S9 41-1011

8. Domain d1xc6a4: 1xc6 A:395-569 [115109]
   Other proteins in same PDB: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a5
   complexed with edo, gal, iod, na, nag, po4

Details for d1xc6a4

PDB Entry: 1xc6, 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1xc6a4:

Sequence; same for both SEQRES and ATOM records:

>d1xc6a4 b.71.1.5 (A:395-569) Beta-galactosidase LacA, domain 2 {Penicillium sp. [TaxId: 5081]}
gylvanpgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsa
gnltipqlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpge
hhefavsgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflld

Timeline for d1xc6a4:

• d1xc6a4 first appeared in SCOP 1.71
  
• d1xc6a4 appears in SCOP 1.75
  
• d1xc6a4 appears in SCOPe 2.02
  
• d1xc6a4 appears in the current release, SCOPe 2.08