| Class b: All beta proteins [48724] (165 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.5: Beta-galactosidase LacA, domain 2 [117301] (1 protein) contains extra C-terminal beta-sandwich subdomain [greek-key; partial topological similarity to the immunoglobulin-like fold] |
| Protein Beta-galactosidase LacA, domain 2 [117302] (1 species) |
| Species Penicillium sp. [TaxId:5081] [117303] (2 PDB entries) |
| Domain d1xc6a4: 1xc6 A:395-569 [115109] Other proteins in same PDB: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a5 complexed with edo, gal, iod, man, na, nag, po4 |
PDB Entry: 1xc6 (more details), 2.1 Å
SCOP Domain Sequences for d1xc6a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xc6a4 b.71.1.5 (A:395-569) Beta-galactosidase LacA, domain 2 {Penicillium sp. [TaxId: 5081]}
gylvanpgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsa
gnltipqlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpge
hhefavsgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflld
Timeline for d1xc6a4:
View in 3DDomains from same chain: (mouse over for more information) d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a5 |