Lineage for d1xc6a4 (1xc6 A:395-569)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566400Family b.71.1.5: Beta-galactosidase LacA, domain 2 [117301] (1 protein)
    contains extra C-terminal beta-sandwich subdomain [greek-key; partial topological similarity to the immunoglobulin-like fold]
  6. 566401Protein Beta-galactosidase LacA, domain 2 [117302] (1 species)
  7. 566402Species Penicillium sp. [TaxId:5081] [117303] (2 PDB entries)
  8. 566404Domain d1xc6a4: 1xc6 A:395-569 [115109]
    Other proteins in same PDB: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a5
    complexed with edo, gal, iod, man, na, nag, po4

Details for d1xc6a4

PDB Entry: 1xc6 (more details), 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose

SCOP Domain Sequences for d1xc6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc6a4 b.71.1.5 (A:395-569) Beta-galactosidase LacA, domain 2 {Penicillium sp.}
gylvanpgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsa
gnltipqlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpge
hhefavsgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflld

SCOP Domain Coordinates for d1xc6a4:

Click to download the PDB-style file with coordinates for d1xc6a4.
(The format of our PDB-style files is described here.)

Timeline for d1xc6a4: