Lineage for d1xc6a2 (1xc6 A:667-848)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774885Family b.18.1.27: Beta-galactosidase LacA, domains 4 and 5 [117111] (1 protein)
    duplication: tandem repeat of two similar domains; some sequence similarity to the beta-Galactosidase/glucuronidase N-terminal domain (49803)
  6. 2774886Protein Beta-galactosidase LacA, domains 4 and 5 [117112] (1 species)
  7. 2774887Species Penicillium sp. [TaxId:5081] [117113] (2 PDB entries)
    Uniprot Q700S9 41-1011
  8. 2774890Domain d1xc6a2: 1xc6 A:667-848 [115107]
    Other proteins in same PDB: d1xc6a1, d1xc6a4, d1xc6a5
    complexed with edo, gal, iod, na, nag, po4

Details for d1xc6a2

PDB Entry: 1xc6 (more details), 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1xc6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc6a2 b.18.1.27 (A:667-848) Beta-galactosidase LacA, domains 4 and 5 {Penicillium sp. [TaxId: 5081]}
apkvqlpslkslkwksvdtlpeakntyddsawtsadhaytnnsahslqtptslfasdygy
htgallfrghftangkektffvqtkggtayghsiwinetyvgswagtsindnnnatytlp
tlqsgknyvitvvidnmgldedwtigsedmknprgiiqyslsgqeasaiswkltgnlgge
ny

SCOPe Domain Coordinates for d1xc6a2:

Click to download the PDB-style file with coordinates for d1xc6a2.
(The format of our PDB-style files is described here.)

Timeline for d1xc6a2: