Lineage for d1xc6a1 (1xc6 A:570-666)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680873Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
    sandwich; 8 strands in 2 sheets
  4. 680874Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (1 family) (S)
  5. 680875Family b.149.1.1: Beta-galactosidase LacA, domain 3 [117101] (1 protein)
  6. 680876Protein Beta-galactosidase LacA, domain 3 [117102] (1 species)
  7. 680877Species Penicillium sp. [TaxId:5081] [117103] (2 PDB entries)
  8. 680879Domain d1xc6a1: 1xc6 A:570-666 [115106]
    Other proteins in same PDB: d1xc6a2, d1xc6a3, d1xc6a4, d1xc6a5
    complexed with edo, gal, iod, man, na, nag, po4

Details for d1xc6a1

PDB Entry: 1xc6 (more details), 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose
PDB Compounds: (A:) beta-galactosidase

SCOP Domain Sequences for d1xc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc6a1 b.149.1.1 (A:570-666) Beta-galactosidase LacA, domain 3 {Penicillium sp. [TaxId: 5081]}
rnsaynywvpqvptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattp
ievvgapsgaknlvingkktqtkvdkngiwsasvayt

SCOP Domain Coordinates for d1xc6a1:

Click to download the PDB-style file with coordinates for d1xc6a1.
(The format of our PDB-style files is described here.)

Timeline for d1xc6a1: