SCOPe 2.08: Domain d1xc6a1: 1xc6 A:570-666

Lineage for d1xc6a1 (1xc6 A:570-666)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
   sandwich; 8 strands in 2 sheets

4. Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families)
   automatically mapped to Pfam PF13363

5. Family b.149.1.1: Beta-galactosidase LacA, domain 3 [117101] (1 protein)

6. Protein Beta-galactosidase LacA, domain 3 [117102] (1 species)

7. Species Penicillium sp. [TaxId:5081] [117103] (2 PDB entries)
   Uniprot Q700S9 41-1011

8. Domain d1xc6a1: 1xc6 A:570-666 [115106]
   Other proteins in same PDB: d1xc6a2, d1xc6a3, d1xc6a4, d1xc6a5
   complexed with edo, gal, iod, na, nag, po4

Details for d1xc6a1

PDB Entry: 1xc6, 2.1 Å

PDB Description: native structure of beta-galactosidase from penicillium sp. in complex with galactose

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1xc6a1:

Sequence; same for both SEQRES and ATOM records:

>d1xc6a1 b.149.1.1 (A:570-666) Beta-galactosidase LacA, domain 3 {Penicillium sp. [TaxId: 5081]}
rnsaynywvpqvptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattp
ievvgapsgaknlvingkktqtkvdkngiwsasvayt

Timeline for d1xc6a1:

• d1xc6a1 first appeared in SCOP 1.71
  
• d1xc6a1 appears in SCOPe 2.07