| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
| Protein Putative fructokinase YhdR [117642] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [117643] (4 PDB entries) Uniprot O05510 |
| Domain d1xc3a2: 1xc3 A:119-294 [115103] Other proteins in same PDB: d1xc3a3 Structural genomics target complexed with gol, pt, zn |
PDB Entry: 1xc3 (more details), 2.1 Å
SCOPe Domain Sequences for d1xc3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xc3a2 c.55.1.10 (A:119-294) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]}
gldsclyitigtgigagaivegrllqglshpemghiyirrhpddvyqgkcpyhgdcfegl
asgpaiearwgkkaadlsdiaqvwelegyyiaqalaqyililapkkiilgggvmqqkqvf
syiyqyvpkimnsyldfselsddisdyivpprlgsnagiigtlvlahqalqaeaas
Timeline for d1xc3a2: