Lineage for d1xc3a1 (1xc3 A:1-118)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) 
duplication contains two domains of this fold
Family c.55.1.10: ROK [110636] (2 proteins)
Pfam 00480
Protein Putative fructokinase YhdR [117642] (1 species) Species Bacillus subtilis [TaxId:1423] [117643] (1 PDB entry) 
Domain d1xc3a1: 1xc3 A:1-118 [115102]
Details for d1xc3a1
PDB Entry: 1xc3 (more details), 2.1 Å
PDB Description: structure of a putative fructokinase from bacillus subtilis
SCOP Domain Sequences for d1xc3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis}
mlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfgp
vdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeak
SCOP Domain Coordinates for d1xc3a1:
Click to download the PDB-style file with coordinates for d1xc3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xc3a1:
- d1xc3a1 is new in SCOP 1.71
- d1xc3a1 appears in SCOP 1.73
- d1xc3a1 appears in the current release, SCOPe 2.08
View in 3D
