Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.5: PG130-like [102959] (6 proteins) subfamily of Pfam PF03992 |
Protein Hypothetical protein IsdG [117934] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry) Uniprot Q8NX62 |
Domain d1xbwc_: 1xbw C: [115098] Structural genomics target |
PDB Entry: 1xbw (more details), 1.9 Å
SCOPe Domain Sequences for d1xbwc_:
Sequence, based on SEQRES records: (download)
>d1xbwc_ d.58.4.5 (C:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]} tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk skqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
>d1xbwc_ d.58.4.5 (C:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]} tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk skqaftdwlksspiinnkvitydigysymk
Timeline for d1xbwc_: