SCOP 1.71: Domain d1xbwc_: 1xbw C:

Lineage for d1xbwc_ (1xbw C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (4 proteins)
   subfamily of Pfam 03992

6. Protein Hypothetical protein IsdG [117934] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry)

8. Domain d1xbwc_: 1xbw C: [115098]

Details for d1xbwc_

PDB Entry: 1xbw, 1.9 Å

PDB Description: 1.9A Crystal Structure of the protein isdG from Staphylococcus aureus aureus, Structural genomics, MCSG

SCOP Domain Sequences for d1xbwc_:

Sequence, based on SEQRES records:

>d1xbwc_ d.58.4.5 (C:) Hypothetical protein IsdG {Staphylococcus aureus}
tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk
skqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk

Sequence, based on observed residues (ATOM records):

>d1xbwc_ d.58.4.5 (C:) Hypothetical protein IsdG {Staphylococcus aureus}
tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk
skqaftdwlksspiinnkvitydigysymk

Timeline for d1xbwc_:

• d1xbwc_ is new in SCOP 1.71
  
• d1xbwc_ appears in SCOP 1.73
  
• d1xbwc_ appears in the current release, SCOPe 2.08, called d1xbwc1