SCOPe 2.05: Domain d1xbwb_: 1xbw B:

Lineage for d1xbwb_ (1xbw B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein IsdG [117934] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry)
   Uniprot Q8NX62

8. Domain d1xbwb_: 1xbw B: [115097]
   Structural genomics target

Details for d1xbwb_

PDB Entry: 1xbw, 1.9 Å

PDB Description: 1.9A Crystal Structure of the protein isdG from Staphylococcus aureus aureus, Structural genomics, MCSG

PDB Compounds: (B:) hypothetical protein isdG

SCOPe Domain Sequences for d1xbwb_:

Sequence, based on SEQRES records:

>d1xbwb_ d.58.4.5 (B:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]}
tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk
skqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk

Sequence, based on observed residues (ATOM records):

>d1xbwb_ d.58.4.5 (B:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]}
tmkfmaenrltltkgtakdiierfytgietlegfdgmfvtqtleqedfdevkiltvwksk
qaftdwlkvrsknedesspiinnkvitydigysymk

Timeline for d1xbwb_:

• d1xbwb_ first appeared in SCOP 1.71
  
• d1xbwb_ appears in SCOPe 2.04
  
• d1xbwb_ is called d1xbwb1 in SCOPe 2.06
  
• d1xbwb_ appears in the current release, SCOPe 2.08, called d1xbwb1