Lineage for d1xbwa1 (1xbw A:1-107)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556692Family d.58.4.5: PG130-like [102959] (6 proteins)
    subfamily of Pfam PF03992
  6. 2556698Protein Hypothetical protein IsdG [117934] (1 species)
  7. 2556699Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry)
    Uniprot Q8NX62
  8. 2556700Domain d1xbwa1: 1xbw A:1-107 [115096]
    Other proteins in same PDB: d1xbwa2, d1xbwb2, d1xbwc2, d1xbwd2
    Structural genomics target

Details for d1xbwa1

PDB Entry: 1xbw (more details), 1.9 Å

PDB Description: 1.9A Crystal Structure of the protein isdG from Staphylococcus aureus aureus, Structural genomics, MCSG
PDB Compounds: (A:) hypothetical protein isdG

SCOPe Domain Sequences for d1xbwa1:

Sequence, based on SEQRES records: (download)

>d1xbwa1 d.58.4.5 (A:1-107) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]}
mkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwks
kqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk

Sequence, based on observed residues (ATOM records): (download)

>d1xbwa1 d.58.4.5 (A:1-107) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]}
mkfmaenrltltkgtakdiierfytrhgietlgfdgmfvtqtleqedfdevkiltvwksk
qaftdwlksdvfkaahkhvpiinnkvitydigysymk

SCOPe Domain Coordinates for d1xbwa1:

Click to download the PDB-style file with coordinates for d1xbwa1.
(The format of our PDB-style files is described here.)

Timeline for d1xbwa1: