![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.5: PG130-like [102959] (4 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein IsdG [117934] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry) |
![]() | Domain d1xbwa_: 1xbw A: [115096] |
PDB Entry: 1xbw (more details), 1.9 Å
SCOP Domain Sequences for d1xbwa_:
Sequence, based on SEQRES records: (download)
>d1xbwa_ d.58.4.5 (A:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]} etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
>d1xbwa_ d.58.4.5 (A:) Hypothetical protein IsdG {Staphylococcus aureus [TaxId: 1280]} etmkfmaenrltltkgtakdiierfytrhgietlgfdgmfvtqtleqedfdevkiltvwk skqaftdwlksdvfkaahkhvpiinnkvitydigysymk
Timeline for d1xbwa_: