Lineage for d1xbwa_ (1xbw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603552Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 603617Family d.58.4.5: PG130-like [102959] (4 proteins)
    subfamily of Pfam 03992
  6. 603623Protein Hypothetical protein IsdG [117934] (1 species)
  7. 603624Species Staphylococcus aureus [TaxId:1280] [117935] (1 PDB entry)
  8. 603625Domain d1xbwa_: 1xbw A: [115096]

Details for d1xbwa_

PDB Entry: 1xbw (more details), 1.9 Å

PDB Description: 1.9A Crystal Structure of the protein isdG from Staphylococcus aureus aureus, Structural genomics, MCSG

SCOP Domain Sequences for d1xbwa_:

Sequence, based on SEQRES records: (download)

>d1xbwa_ d.58.4.5 (A:) Hypothetical protein IsdG {Staphylococcus aureus}
etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw
kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk

Sequence, based on observed residues (ATOM records): (download)

>d1xbwa_ d.58.4.5 (A:) Hypothetical protein IsdG {Staphylococcus aureus}
etmkfmaenrltltkgtakdiierfytrhgietlgfdgmfvtqtleqedfdevkiltvwk
skqaftdwlksdvfkaahkhvpiinnkvitydigysymk

SCOP Domain Coordinates for d1xbwa_:

Click to download the PDB-style file with coordinates for d1xbwa_.
(The format of our PDB-style files is described here.)

Timeline for d1xbwa_: