Lineage for d1xbtg2 (1xbt G:151-191)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705625Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 1705626Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. 1705630Species Human (Homo sapiens) [TaxId:9606] [118278] (2 PDB entries)
    Uniprot P04183 18-191
  8. 1705637Domain d1xbtg2: 1xbt G:151-191 [115093]
    Other proteins in same PDB: d1xbta1, d1xbtb1, d1xbtc1, d1xbtd1, d1xbte1, d1xbtf1, d1xbtg1, d1xbth1
    complexed with mg, ttp, zn

Details for d1xbtg2

PDB Entry: 1xbt (more details), 2.4 Å

PDB Description: Crystal Structure of Human Thymidine Kinase 1
PDB Compounds: (G:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d1xbtg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbtg2 g.39.1.14 (G:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk

SCOPe Domain Coordinates for d1xbtg2:

Click to download the PDB-style file with coordinates for d1xbtg2.
(The format of our PDB-style files is described here.)

Timeline for d1xbtg2: