![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
![]() | Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117560] (2 PDB entries) Uniprot P04183 18-191 |
![]() | Domain d1xbtf1: 1xbt F:18-150 [115090] Other proteins in same PDB: d1xbta2, d1xbtb2, d1xbtc2, d1xbtd2, d1xbte2, d1xbtf2, d1xbtg2, d1xbth2 complexed with mg, ttp, zn |
PDB Entry: 1xbt (more details), 2.4 Å
SCOPe Domain Sequences for d1xbtf1:
Sequence, based on SEQRES records: (download)
>d1xbtf1 c.37.1.24 (F:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail nlvplaesvvklt
>d1xbtf1 c.37.1.24 (F:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
Timeline for d1xbtf1: