Lineage for d1xbtb1 (1xbt B:18-150)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583654Family c.37.1.24: Type II thymidine kinase [117558] (1 protein)
    N-terminal part of Pfam 00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (scop_pr 52684)
  6. 583655Protein Thymidine kinase, TK1, N-terminal domain [117559] (3 species)
  7. 583659Species Human (Homo sapiens) [TaxId:9606] [117560] (1 PDB entry)
  8. 583661Domain d1xbtb1: 1xbt B:18-150 [115082]
    Other proteins in same PDB: d1xbta2, d1xbtb2, d1xbtc2, d1xbtd2, d1xbte2, d1xbtf2, d1xbtg2, d1xbth2

Details for d1xbtb1

PDB Entry: 1xbt (more details), 2.4 Å

PDB Description: Crystal Structure of Human Thymidine Kinase 1

SCOP Domain Sequences for d1xbtb1:

Sequence, based on SEQRES records: (download)

>d1xbtb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens)}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records): (download)

>d1xbtb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens)}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt

SCOP Domain Coordinates for d1xbtb1:

Click to download the PDB-style file with coordinates for d1xbtb1.
(The format of our PDB-style files is described here.)

Timeline for d1xbtb1: