Lineage for d1xbba1 (1xbb A:363-637)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589581Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2589582Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2589600Domain d1xbba1: 1xbb A:363-637 [115077]
    Other proteins in same PDB: d1xbba2
    Structural genomics target
    complexed with sti

Details for d1xbba1

PDB Entry: 1xbb (more details), 1.57 Å

PDB Description: crystal structure of the syk tyrosine kinase domain with gleevec
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d1xbba1:

Sequence, based on SEQRES records: (download)

>d1xbba1 d.144.1.7 (A:363-637) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvneg

Sequence, based on observed residues (ATOM records): (download)

>d1xbba1 d.144.1.7 (A:363-637) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
snfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfss
ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
dvenrpgfaavelrlrnyyydvvneg

SCOPe Domain Coordinates for d1xbba1:

Click to download the PDB-style file with coordinates for d1xbba1.
(The format of our PDB-style files is described here.)

Timeline for d1xbba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xbba2