Lineage for d1xb9g1 (1xb9 G:16-121)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. Protein Nucleophosmin (NO38) [117086] (1 species)
  7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
    Uniprot P07222 16-122
  8. Domain d1xb9g1: 1xb9 G:16-121 [115072]
    Other proteins in same PDB: d1xb9a2, d1xb9b2, d1xb9c2, d1xb9d2, d1xb9e2, d1xb9f2, d1xb9g2, d1xb9h2, d1xb9i2, d1xb9j2

Details for d1xb9g1

PDB Entry: 1xb9 (more details), 1.9 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone chaperone in the nucleolus
PDB Compounds: (G:) Nucleophosmin

SCOPe Domain Sequences for d1xb9g1:

Sequence, based on SEQRES records: (download)

>d1xb9g1 b.121.3.1 (G:16-121) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval

Sequence, based on observed residues (ATOM records): (download)

>d1xb9g1 b.121.3.1 (G:16-121) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkvdenehqlslrtvslgasakdelhvveaeginyegktikia
laslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval

SCOPe Domain Coordinates for d1xb9g1 are not available.

Timeline for d1xb9g1:

Domains from same chain:
(mouse over for more information)
d1xb9g2
Domains from other chains:
(mouse over for more information)
d1xb9a1, d1xb9a2, d1xb9b1, d1xb9b2, d1xb9c1, d1xb9c2, d1xb9d1, d1xb9d2, d1xb9e1, d1xb9e2, d1xb9f1, d1xb9f2, d1xb9h1, d1xb9h2, d1xb9i1, d1xb9i2, d1xb9j1, d1xb9j2