Lineage for d1xb9e_ (1xb9 E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679605Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 679704Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) (S)
    oligomerizes into a pentameric ring structure
  5. 679705Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins)
  6. 679713Protein Nucleophosmin (NO38) [117086] (1 species)
  7. 679714Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
  8. 679729Domain d1xb9e_: 1xb9 E: [115070]

Details for d1xb9e_

PDB Entry: 1xb9 (more details), 1.9 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone chaperone in the nucleolus
PDB Compounds: (E:) Nucleophosmin

SCOP Domain Sequences for d1xb9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb9e_ b.121.3.1 (E:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti
kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlva

SCOP Domain Coordinates for d1xb9e_:

Click to download the PDB-style file with coordinates for d1xb9e_.
(The format of our PDB-style files is described here.)

Timeline for d1xb9e_: