SCOPe 2.06: Domain d1xb9b1: 1xb9 B:16-121

Lineage for d1xb9b1 (1xb9 B:16-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families)
   oligomerizes into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
   automatically mapped to Pfam PF03066

6. Protein Nucleophosmin (NO38) [117086] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
   Uniprot P07222 16-122

8. Domain d1xb9b1: 1xb9 B:16-121 [115067]
   Other proteins in same PDB: d1xb9a2, d1xb9b2, d1xb9c2, d1xb9d2, d1xb9e2, d1xb9f2, d1xb9g2, d1xb9h2, d1xb9i2, d1xb9j2

Details for d1xb9b1

PDB Entry: 1xb9, 1.9 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone chaperone in the nucleolus

PDB Compounds: (B:) Nucleophosmin

SCOPe Domain Sequences for d1xb9b1:

Sequence; same for both SEQRES and ATOM records:

>d1xb9b1 b.121.3.1 (B:16-121) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval

Timeline for d1xb9b1:

• d1xb9b1 first appeared in SCOP 1.71, called d1xb9b_
  
• d1xb9b1 was called d1xb9b_ in SCOPe 2.05
  
• d1xb9b1 appears in SCOPe 2.07
  
• d1xb9b1 appears in the current release, SCOPe 2.08