![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) ![]() oligomerizes into a pentameric ring structure |
![]() | Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins) |
![]() | Protein Nucleophosmin (NO38) [117086] (1 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries) |
![]() | Domain d1xb9a_: 1xb9 A: [115066] |
PDB Entry: 1xb9 (more details), 1.9 Å
SCOP Domain Sequences for d1xb9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb9a_ b.121.3.1 (A:) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis)} sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
Timeline for d1xb9a_: