Lineage for d1xb9a1 (1xb9 A:16-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821688Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 2821689Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 2821697Protein Nucleophosmin (NO38) [117086] (1 species)
  7. 2821698Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries)
    Uniprot P07222 16-122
  8. 2821709Domain d1xb9a1: 1xb9 A:16-122 [115066]
    Other proteins in same PDB: d1xb9a2, d1xb9b2, d1xb9c2, d1xb9d2, d1xb9e2, d1xb9f2, d1xb9g2, d1xb9h2, d1xb9i2, d1xb9j2

Details for d1xb9a1

PDB Entry: 1xb9 (more details), 1.9 Å

PDB Description: The structure and function of Xenopus NO38-core, a histone chaperone in the nucleolus
PDB Compounds: (A:) Nucleophosmin

SCOPe Domain Sequences for d1xb9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb9a1 b.121.3.1 (A:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik
ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale

SCOPe Domain Coordinates for d1xb9a1:

Click to download the PDB-style file with coordinates for d1xb9a1.
(The format of our PDB-style files is described here.)

Timeline for d1xb9a1: