Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins) automatically mapped to Pfam PF03066 |
Protein Nucleophosmin (NO38) [117086] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [117087] (2 PDB entries) Uniprot P07222 16-122 |
Domain d1xb9a1: 1xb9 A:16-122 [115066] Other proteins in same PDB: d1xb9a2, d1xb9b2, d1xb9c2, d1xb9d2, d1xb9e2, d1xb9f2, d1xb9g2, d1xb9h2, d1xb9i2, d1xb9j2 |
PDB Entry: 1xb9 (more details), 1.9 Å
SCOPe Domain Sequences for d1xb9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb9a1 b.121.3.1 (A:16-122) Nucleophosmin (NO38) {African clawed frog (Xenopus laevis) [TaxId: 8355]} qnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegktik ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
Timeline for d1xb9a1: